Protein Info for SO0795 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 TIGR03549: YcaO domain protein" amino acids 4 to 583 (580 residues), 1189.2 bits, see alignment E=0 TIGR00702: YcaO-type kinase domain" amino acids 19 to 407 (389 residues), 335.5 bits, see alignment E=4.3e-104 PF02624: YcaO" amino acids 65 to 396 (332 residues), 220.8 bits, see alignment E=3e-69 PF18381: YcaO_C" amino acids 413 to 583 (171 residues), 238.2 bits, see alignment E=5.2e-75

Best Hits

Swiss-Prot: 49% identical to Y1265_HAEIN: Uncharacterized protein HI_1265 (HI_1265) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09136, ribosomal protein S12 methylthiotransferase (inferred from 100% identity to son:SO_0795)

Predicted SEED Role

"FIG01057284: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIP2 at UniProt or InterPro

Protein Sequence (592 amino acids)

>SO0795 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MGHAAGESSTYILGKDLPLEQTIANMTAMLADLGMKIEISSWRNIVPNVWSLHIRDAASP
MCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGVEIANSEFVHYPNEKWFALEKD
DSLPVGLLDDYCLEIYNPDEELCGSHLIDTNSGNRERGICAIPYTRKSDGETVYFPSNLI
ENLFLSNGMSAGNNLKEAEVQCLSEIFERAVKRQIIEQEIVLPDVPMSVLEKYPSILAGI
KGLEEQDFPVVVKDASLGGQFPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQG
RSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRFFSSKHDYEFCEWDFSGTNEE
EADRLFGILEDLGKEVYVAELTQLGASACRILVPDYSEVYPVEDLIWDNTNKALDYREDI
LNLHSLSTKQLVNLVNRLEESQLDNYTDIRTLIGIVFDENTVWGKLTIIELKILIYLALG
EHEEALELVGEFLQFNDNTVKRNLFYQAMSAVLEVTLDEDLALEDFSHNFTRMFGEEVMA
QVVGSVTGKVRFSGLTKTSMQLEGIEPHLRLIESYKKLHSARKANAVKCITF