Protein Info for SO0772 in Shewanella oneidensis MR-1

Annotation: oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF08659: KR" amino acids 5 to 162 (158 residues), 28.1 bits, see alignment E=4.6e-10 PF01370: Epimerase" amino acids 5 to 168 (164 residues), 37 bits, see alignment E=6.7e-13 PF00106: adh_short" amino acids 5 to 184 (180 residues), 88.5 bits, see alignment E=1e-28 PF13561: adh_short_C2" amino acids 11 to 237 (227 residues), 98.1 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K13938, dihydromonapterin reductase / dihydrofolate reductase [EC: 1.5.1.- 1.5.1.3] (inferred from 100% identity to son:SO_0772)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.- or 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIR4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>SO0772 oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file) (Shewanella oneidensis MR-1)
MTAPIIITGVGKRIGYALAKHLLAQGHKVIGTYRSHYPSIDELQSLGATLIQCDFYDNAQ
VQNLIEQLSQYPKFRAIIHNASDWLADNSPEFAAHEVMQRMIQVHVNVPYQMNLALASKL
QAGAEGEIGASDIIHITDYVAEKGSAKHIAYAASKAALDNLTLSFAAKLAPEVKVNAIAP
AMILFNPSDDEAYRQKTLAKAILPKEAGNHEIIELMEYLLNSRYVTGRSHHVDGGRHLR