Protein Info for SO0760 in Shewanella oneidensis MR-1

Name: amt
Annotation: ammonium transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details TIGR03644: probable ammonium transporter, marine subtype" amino acids 8 to 401 (394 residues), 668 bits, see alignment E=2.2e-205 PF00909: Ammonium_transp" amino acids 15 to 397 (383 residues), 329.9 bits, see alignment E=1e-102

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0760)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIS5 at UniProt or InterPro

Protein Sequence (408 amino acids)

>SO0760 ammonium transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MTVSELRFALDTFYFLISGALVMWMAAGFAMLEAGLVRSKNTTEILTKNVVLYAIACVMY
LLVGYNIMYVDNAEGGWLPSFGTLIGSQAADANHALESDFFFQVVFVATAMSIVSGAVAE
RMKLWAFLVFSVVMTGIIYPVEGYWTWGKGFIASLGFVDFAGSGIVHMTGAAAAIAGVLL
LGARKGKYGPNGQVNPIPGSNLPMATLGMFILWMGWFGFNGGSQLMVSDAANASAVAKVF
VNTNTAAALGAISALIVCKMIWGKADLTMILNGILAGLVAITADPLSPSLLMAGVIGLVA
GGLVVFSIVGLDRIKIDDPVGAISVHGVAGFLGLMCVPLSNANATITAQLTGAAIIFAWV
FSASFAVWFVLKMTMGIRVSEEEEYNGMDASDCGIDAYPEFVTVKSAG