Protein Info for SO0754 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 34 to 308 (275 residues), 153.9 bits, see alignment E=7.3e-49 PF00005: ABC_tran" amino acids 369 to 518 (150 residues), 118.7 bits, see alignment E=3e-38

Best Hits

Swiss-Prot: 51% identical to ATM1_CHAGB: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to son:SO_0754)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIT1 at UniProt or InterPro

Protein Sequence (596 amino acids)

>SO0754 ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRPTLYFEGPIDKLNWHVIKLLWPYLLEYKGRVALAMSCLIVAKLASVGLPFILKDVVDT
LDANKTAQTLSVPIGLVLAYGAVRLLTVITGEIRDTLFGRVTERAIRRLGLAVFDHLHRL
DLDFHLERRTGGLSRDIERGTSGVSFLMRFMVFNIVPTLLEIAMVIGIFFFNYGVAFASI
TFISVLAYIWFSVIATEWRTEYVRDAAKADSLSNTRAIDSLLNYETVKYFNNEKYESERY
DQALDQWEVAKRKNRLSLFALNGGQALIIAIAMTAMMALAAYKVTHNEMTLGDFVLINAF
MMQLFMPLNFLGFVYREIRGALANIERMFSLLDKHPSIVDKPDALDFEPKRGELSFENVS
FSYDDRPILRNVSFKVAAGKKVAVVGDSGAGKSTLIKLLFRFYDVEQGRILIDGQDIRQL
TQDALRRAIAIVPQDTVLFNDSLVENIRYGRPNASDDDVRHAIKLAHLEDFIASLSQGWD
TKVGERGLKLSGGEKQRVAIARAILKGSPVLVFDEATSSLDSRSEQAILSALREVAKGHT
SLVVAHRLSTIVDADQIVVLSKGEIVEQGNHSSLLAQDGLYAKLWRIQNEQQHLSV