Protein Info for SO0610 in Shewanella oneidensis MR-1

Name: petC
Annotation: ubiquinol-cytochrome c reductase, cytochrome c1 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 204 to 222 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 31 to 229 (199 residues), 84.4 bits, see alignment E=4.9e-28

Best Hits

Swiss-Prot: 44% identical to PETC_NITEU: Ammonia monooxygenase gamma subunit (petC) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 100% identity to son:SO_0610)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJ62 at UniProt or InterPro

Protein Sequence (231 amino acids)

>SO0610 ubiquinol-cytochrome c reductase, cytochrome c1 (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKLLIALVTLLPTLAIAAGGQVHLEDANVDLHDKASLERGLGLFQHYCSGCHSTQYQRY
ERVANDLGISADDMRNKYMFTDAKIGELMQNAIPPKDAAKWFGATPPDLTLVARVRGEDW
VYSYLKGFYKDPSRPFGVNNTVFPSVGMPHVLEELQGTPVKQEDGTIVVSGGKLNAEEYD
QAVRDITGFLVYSAEPVKLERQALGWWVLGFLFIFFIVAYLLKKEYWKDVH