Protein Info for SO0598 in Shewanella oneidensis MR-1

Name: yjeF
Annotation: yjeF protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR00197: YjeF family N-terminal domain" amino acids 31 to 218 (188 residues), 125.8 bits, see alignment E=1.9e-40 PF03853: YjeF_N" amino acids 35 to 197 (163 residues), 133.8 bits, see alignment E=9.3e-43 TIGR00196: YjeF family C-terminal domain" amino acids 238 to 495 (258 residues), 236.6 bits, see alignment E=3.3e-74 PF01256: Carb_kinase" amino acids 253 to 488 (236 residues), 213.5 bits, see alignment E=5.1e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0598)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJ73 at UniProt or InterPro

Protein Sequence (499 amino acids)

>SO0598 yjeF protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAQDLSSLPTALFTQEQVRDAELLAVSEGKTTLYQLVERAGRAAFDCLATQIARQPRLES
MPLLVLAGSGNNGADALVCARLALEAGHKVMVFLLKTKGTPEFEQALSAYLNQGGIADSP
NIDAILQAPMLIDGLLGTGVHGGVREEVAALIQAINQSDAWVLSLDLPSGIVADTGVVAQ
AAVMADLTLCFGGLKQGLLTSKARHYCGDLDFADLGLTPFFKTPNATRVGGEILKSYFAA
RARDSHKGQSGKVTLIGGDFGMAGAIRLASEACLRAGAGLVTVISRPEHQLTVNVSRPEL
MFWGCELVDMEVYLRLGWAQVVVLGPGLGKHDWGYNLFKAAGLSDKPCVLDADALNLLSN
EPRRQTNWVLTPHPGEAARLLGCNVAEIEQDRFAAVRALQQKYGGVVLLKGAGTVIFDGK
QMVVAPVGNPGLASGGCGDVLSGIIGALMAQGMDNMQATVVGVVVHGCAADLAAVQGERG
MLASDLMPFIRQLVNSDLL