Protein Info for SO0575 in Shewanella oneidensis MR-1

Name: hepA
Annotation: RNA polymerase-associated protein HepA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 968 PF18339: Tudor_1_RapA" amino acids 3 to 53 (51 residues), 87.4 bits, see alignment 1.8e-28 PF18337: Tudor_RapA" amino acids 55 to 117 (63 residues), 89.8 bits, see alignment 3.8e-29 PF04851: ResIII" amino acids 168 to 315 (148 residues), 38.1 bits, see alignment E=5.4e-13 PF00270: DEAD" amino acids 172 to 315 (144 residues), 26 bits, see alignment E=2.6e-09 PF00176: SNF2-rel_dom" amino acids 172 to 344 (173 residues), 62.3 bits, see alignment E=1.4e-20 PF00271: Helicase_C" amino acids 492 to 602 (111 residues), 63.3 bits, see alignment E=8.7e-21 PF12137: RapA_C" amino acids 606 to 964 (359 residues), 488.2 bits, see alignment E=5.2e-150

Best Hits

Swiss-Prot: 61% identical to RAPA_ALIFM: RNA polymerase-associated protein RapA (rapA) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 58% identity to ddc:Dd586_3567)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJ93 at UniProt or InterPro

Protein Sequence (968 amino acids)

>SO0575 RNA polymerase-associated protein HepA (NCBI ptt file) (Shewanella oneidensis MR-1)
MPFALGQRWISDTESELGLGTVVQVEGRMVTVLFPATGENRMFSRNEAPLTRVIYNPGDT
VESHEGWSLSVEELTEKDDLVVYHGIHSETGEKVSLRETLLNHNIRFNKPQDRLFAGQID
RLDRFGIRYQCQLLRHQLATSDLLGLQGPRVGLIPHQMWIAHEVGRRYAPRVLLADEVGL
GKTIEAGLIIHQQLLTCRAERVLIIVPDTLRHQWLVEMLRRFNLRFSVFDEDRCVEAFAD
HDNPFYTEQLVICSLELLRKKKRLDQALDADWDLLVVDEAHHLEWTEEAPSRAYQVVEAL
SEVVPGVLLLTATPDQLGHESHFARLRLLDPDRFYDYDAFLAEENSYKDVAIAAEALAGE
SKLSDYAINSLTELLSEKDIAPSIRLIQAEGIDSELQQAARSELLQELLDRHGTGRVLYR
NSRASVKGFPKRIFNAYPHAMPEQYLTAARVNDMMGGRKSLEAKAAQALSPEKLYQEFED
NSASWWKFDPRVDWLIEFLKSHRSKKVLIIASGADTALSLEEALRTREGIQATVFHEGMS
IIERDKAGAYFAQEEGGAQALICSEIGSEGRNFQFASHLVLFDLPLNPDLLEQRIGRLDR
IGQKNDIQIHLPYLQDTAQERLLQWYHQGLNAFELTCPGGHILFSEFAEELLNVLVGGDE
DELTNLLNHTQSRYKELKHAMEQGRDKLLEINSHGGDKAKAIVERLAQSDQDTKLIGSVI
RLWDIIGVDQEDKGENSIILRPSEHMMFPTYPGLHEDGVTVTFDRDTALSRDDIALITQE
HPLVQTGLDLITGSDTGTTSVAILKNKALPAGTLFLELIYMADASAPKSSQLYRYLPPTP
IRILLDKNGNDLSAKVDYTSFDKQLSAVNRHIGSKLVTASQPILHPLFAKGEEYAQVAVN
ELVAQAREKMTSQLTGELERLESLKAVNPNIREEELEYLRNQMQELTTYLDASQLQLDAI
RMVLVSHV