Protein Info for SO0545 in Shewanella oneidensis MR-1

Annotation: response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 64.4 bits, see alignment E=1.5e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 139 to 301 (163 residues), 148.1 bits, see alignment E=9.8e-48 PF00990: GGDEF" amino acids 142 to 299 (158 residues), 156.3 bits, see alignment E=9.1e-50 PF00563: EAL" amino acids 320 to 557 (238 residues), 224.3 bits, see alignment E=2.2e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0545)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJC2 at UniProt or InterPro

Protein Sequence (575 amino acids)

>SO0545 response regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MYMDLLLIDDDEVDRTAIIRALRQSKLAFNVVEANCAFDGLNLALQRHFDGILLDYLLPD
ANGLEVLIKLNSMTQEQTVVVMLSRYEDEKLAQRCIELGAQDFLLKDEVNSRILSRSIRY
AKQRASMALALRNSHEKLKELAEHDSLTKLMNRYGFELCLNRAIARVKRSNDLLAVILLD
LDDFKAINDTLGHQTGDILLVKVASRLSTVLRDGDVIARLGGDEFVVLVTDNDYKYFPMI
VANRLLKAFEEVFCLGDNDVMIGASIGVAFYNEAASDSSELMKCADIAMYRAKKMGRNQI
QFYSEALDKEVRYRNHIESSLRIALRLNQFKVYYQVQVDAQTHQMVGMEALIRWLHPEDG
LISPDQFLPIAEEIGLMEEIGDWVLFETCRQAQYWLNQLAPTGHSFTIAVNLSASQIGHV
DLYEKIAHVLKVTGLTPGALELEITENCLIEEPHEHAKILDKIAQLGVRFALDDFGTGFS
SLEHIKLFPISVLKIDKSFIASYDKDEKDTRLLSALLNFAYGFNVTSVAEGIETLEQAEF
CTVRHCNLLQGYLFSRPLEASEFEAKYITPLLSKL