Protein Info for SO0535 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 269 to 296 (28 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details PF03773: ArsP_1" amino acids 25 to 326 (302 residues), 222 bits, see alignment E=4.9e-70

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to son:SO_0535)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJD2 at UniProt or InterPro

Protein Sequence (331 amino acids)

>SO0535 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFQIFTDFATWLVYGMFGLEAGSALGGAVHFFVEDVSKIFVLLLVMIYVIALLRASLDVE
RVRDYLAGKNKGVGYLLGSIFGAITPFCSCSSIPVFLGFTSAGIPLGITIAFLITSPLIN
EVAVLLLMSLLGWKFTLLYVAVGMTVGMLGGVLLDAMKAERWLQSFAAEALLRGRQMAAS
DVVSTVARVLSLSERHQFAKAEAIEIFGRVWKWVIIGVGLGAALHGFVPEGWIEAHLGQG
QWWSVPVAVLIGIPLYSNATGIIPVMESLLANGLPIGTTLAFCMSTVAASFPEFILLKQV
MQWRLLALLLVVLLTAFTLVGWMFNFAAPYL