Protein Info for SO0532 in Shewanella oneidensis MR-1

Name: arsR
Annotation: arsenical resistence operon repressor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01022: HTH_5" amino acids 12 to 57 (46 residues), 49.1 bits, see alignment E=2.1e-17

Best Hits

Swiss-Prot: 55% identical to ARSR2_PSEPK: Arsenic resistance transcriptional regulator ArsR2 (arsR2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to son:SO_0532)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJD5 at UniProt or InterPro

Protein Sequence (114 amino acids)

>SO0532 arsenical resistence operon repressor (NCBI ptt file) (Shewanella oneidensis MR-1)
MQPVTFFKALADETRLKCLLLIQREGELCVCELMAALSEIQPKVSRHLAQLKKAGLLVDR
RQGQWVFYRINAELSPWCQQVLARTCDDNDIFLQDNLRNLCQMGGRPERAKACC