Protein Info for SO0511 in Shewanella oneidensis MR-1

Name: accB
Annotation: acetyl-CoA carboxylase, biotin carboxyl carrier protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein" amino acids 3 to 147 (145 residues), 120.7 bits, see alignment E=3.8e-39 PF00364: Biotin_lipoyl" amino acids 78 to 148 (71 residues), 65.1 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 46% identical to BCCP_ECO57: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli O157:H7

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to son:SO_0511)

MetaCyc: 46% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJF6 at UniProt or InterPro

Protein Sequence (152 amino acids)

>SO0511 acetyl-CoA carboxylase, biotin carboxyl carrier protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAVDLRKIKKLIELVQESGIAELAISEGEESIRITRYSPNPASAQGSAISSTQPSVQPQK
PTQSRNAMPVIEGFVQVSPMVGTFHAAKNLADAPLVRVGQRVIQGDTLCIIEAMRMQNPI
EAERDGIIGAIWVKEGDEVAFDQPLFTLIEIS