Protein Info for SO0505 in Shewanella oneidensis MR-1

Annotation: conserved domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF08238: Sel1" amino acids 134 to 150 (17 residues), 13.1 bits, see alignment (E = 6.3e-06) amino acids 153 to 187 (35 residues), 22.6 bits, see alignment 6.2e-09 amino acids 189 to 222 (34 residues), 26.7 bits, see alignment 3.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0505)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJG2 at UniProt or InterPro

Protein Sequence (247 amino acids)

>SO0505 conserved domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRIDTQEQLVTLLNALFEKVGINLEQVSKLDNYGVMFSVPGTMKPLIATLKTVTTPTNWN
NETNLGHYKSADENWLLCLKPAPHSVFCIATVCSLHEKHLEQYIETSEKKQDRRIAAEHG
DPEAQYYTAQDCEDKTEALFWYRKAGEQNHYWALYQIALMYEAGEGGLEKDFAQAILWRG
KAAEQGSDAAARDLAEMYEEGTADIPQDLTLAIFWYERWLELSPVMRRMIKPKIKSLKAA
LSQRMNE