Protein Info for SO0488 in Shewanella oneidensis MR-1

Name: nosY
Annotation: copper ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 103 (15 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 177 to 202 (26 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 8 to 278 (271 residues), 121.3 bits, see alignment E=7.4e-39 PF12730: ABC2_membrane_4" amino acids 13 to 185 (173 residues), 34.2 bits, see alignment E=3.8e-12 PF12698: ABC2_membrane_3" amino acids 79 to 266 (188 residues), 35.1 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 43% identical to NOSY_PSEAE: Probable ABC transporter permease protein NosY (nosY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to son:SO_0488)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJH7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>SO0488 copper ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MALTLIQAVAVKEFKDNLRNRWLWLMAGMLLILSLCVSFMGSAVSGSLVVSESAQIFSGL
VTLAVFILPLGAILLSYDSFVGERESGTLLLLLTYPLARWHLVCGKLLGHAYVIATACLL
GFGLTALLLVALGEAHARLTLVTGFIHLIGSGILLSLVFVLLGYCVSLCVREKAKALGVL
LLLWFVLVLVYDLVLLTALVSMAEVLSRHLFNLLILINPTDLFRALNLLANPADSLSAKS
SLALIAQSGMGIPLMYGLFVGWLAVLSLICCFIFNRQEV