Protein Info for SO0486 in Shewanella oneidensis MR-1

Name: nosD
Annotation: copper ABC transporter, periplasmic copper-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 30 to 416 (387 residues), 386.3 bits, see alignment E=1.1e-119 PF13229: Beta_helix" amino acids 88 to 220 (133 residues), 40.4 bits, see alignment E=3.6e-14 amino acids 217 to 319 (103 residues), 28.8 bits, see alignment E=1.3e-10 PF05048: NosD" amino acids 142 to 352 (211 residues), 140.6 bits, see alignment E=7.6e-45 TIGR03804: parallel beta-helix repeat" amino acids 282 to 325 (44 residues), 20.6 bits, see alignment 2.7e-08

Best Hits

Swiss-Prot: 41% identical to NOSD_PSEST: Probable ABC transporter binding protein NosD (nosD) from Pseudomonas stutzeri

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 100% identity to son:SO_0486)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJH9 at UniProt or InterPro

Protein Sequence (424 amino acids)

>SO0486 copper ABC transporter, periplasmic copper-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLRLLLLCWLCGVSFIGGAQELRVKDTASLTQALVQAQDGDTLVLDTAVYEGNFSVTRSI
HIKGEAGATLDAQRQGSALTITAPKVIVEGLNIRHWGRDLYYHDAGILLLPGADEVLIKG
NRFVGDGFGIYGEQLASPRIIENSISGNGAIYVLDRGDGIFLKHVTAPDVQQNHIIFVRD
GVYLESVTDSKIHHNQFAKLQYGIHYMYTRGDEASQNQATSVDGGYALMNSQQIYLHHNR
VSQARDFGILLNITNDSHVQANIATEVQHPQGSVELGNEGKGIFIYAAQNNRIEDNEFSQ
SDTGISMAMGGEANRLWHNRILGNQTQVKYVGEAQLEWSYQGQGNYWSEYRGWDTNGDGV
GDIAHRPNDSLDKLFWLYPEAKLLMESPVVLLLRWVERQFQPTSISGVSDSFPLMRLITE
GDGI