Protein Info for SO0483 in Shewanella oneidensis MR-1

Name: nrfC
Annotation: formate-dependent nitrite reductase, nrfC protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13247: Fer4_11" amino acids 100 to 195 (96 residues), 76 bits, see alignment E=8e-25 PF12838: Fer4_7" amino acids 106 to 153 (48 residues), 28.5 bits, see alignment 6.2e-10 PF12837: Fer4_6" amino acids 131 to 153 (23 residues), 25.3 bits, see alignment (E = 3.8e-09) PF00037: Fer4" amino acids 133 to 153 (21 residues), 24.8 bits, see alignment (E = 5e-09)

Best Hits

KEGG orthology group: None (inferred from 99% identity to sbm:Shew185_3873)

MetaCyc: 100% identical to SirC ferredoxin (Shewanella oneidensis MR-1)

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJI2 at UniProt or InterPro

Protein Sequence (235 amino acids)

>SO0483 formate-dependent nitrite reductase, nrfC protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSENIERRRFLKSAGMCSLILTPLAGCSVKEDADSAHKPHYVMVFDQNKCVGCGDCKTAC
NQANNLPAGVSRVILEQQSGRVEGQACPHCGKMVCDCERKFVRVSCQQCKNAPCVTVCPT
GAAHRDAKTGIVTMDASKCAGCKYCIGACPYNARLINNNTDVADNCDFCLHSKLSKGELP
ACVQSCKYDALIFGDANDPQSYVSKLLAVKDSVRIKPQFGTEPSLRYIPIVKLGV