Protein Info for SO0450 in Shewanella oneidensis MR-1

Annotation: major facilitator family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 342 (324 residues), 114.8 bits, see alignment E=4.4e-37 PF06779: MFS_4" amino acids 32 to 369 (338 residues), 43.4 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0450)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJL3 at UniProt or InterPro

Protein Sequence (387 amino acids)

>SO0450 major facilitator family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLAQPNQKPGLFVPVAGLSLFALASGYLMSLIPLSLTYFDLSLDLAPWLASIFYLGLLL
GAPCIAPIVSRIGHSKAFILFLNILLCSVVVMVLLPQTSIWLASRLIAGLAVAGIFVVVE
SWLLMADTQKQRAKRLGLYMTALYGGTAIGQLAVDYLGTTGNLPYLVVIGLLAAASLPAL
LVKRGQPQSSEQHSIALSDLKTLSKPAIAGCLVSGLLLGPIYGLLPIYVSQDMGFAQQTG
QFMALIILGGMIVQPLVSYLSPRIQKSVLMIAFCLVGAAALLLLMQTSLVGLWLGFVLLG
ACAFALYPIAISLACDHLPSSQIVSATQIMLLSYSVGSVIGPVAASRFDDIEHGLPLYLA
ASFLMTACYLSAHLLARSKARLPTAKA