Protein Info for SO0449 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details amino acids 452 to 476 (25 residues), see Phobius details amino acids 487 to 507 (21 residues), see Phobius details PF03929: PepSY_TM" amino acids 13 to 376 (364 residues), 194.9 bits, see alignment E=1.4e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0449)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJL4 at UniProt or InterPro

Protein Sequence (539 amino acids)

>SO0449 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKVRSDVLRVYQSIHIWTGIIAGIVLFIGFYAGSLTMFKGAIDAWSMPPAMTLPQVPAEK
LDDLVSQVLAQDDKAKIGFSLHLNDEHQSPMTWYQQGSERELSMSHQLWHASLDENGLLL
RQLSTSSELAELIDQLHRTAGIAGEVGHDQAGVYVLGIAAVLYFLALVSGVIFLLPTLTK
SFFALRKDKGESRFWLDAHNLVGITSLPFHLVICVTVIVFAFHDQLYDGLKHMVYGEKPL
FAQSAPDRTPYTLADLPKITTVLAKVQQIAPDYQVNEMTFMNLDNPRATLRLGLYNPNGF
MRGPVTDFLYLHPYSLKVSNSTIDQSEQGIWARTVAVFFGLHFGSYGGDLGRWVYFFLGL
SGAFLFYSGNLLWLEKRRKKQASEQTRACRLMASATVGICLGSVAALAVSMLLGKWLYAH
VSNINHVYLWLYYLLFGLLVAYAFWRGAAKAALLILPLCALATLAMPITSLVAVFAPSLG
LWAPYSTATWGVDLVALAFSGVFFYGYKLTRHRVLNGPQDSVWAIAATVPVAELTQQTS