Protein Info for SO0443 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator, MerR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR02043: Zn(II)-responsive transcriptional regulator" amino acids 1 to 131 (131 residues), 234 bits, see alignment E=2.1e-74 PF13411: MerR_1" amino acids 2 to 69 (68 residues), 73.1 bits, see alignment E=2.4e-24 PF00376: MerR" amino acids 3 to 40 (38 residues), 57.5 bits, see alignment 1.5e-19 PF09278: MerR-DNA-bind" amino acids 46 to 110 (65 residues), 69.4 bits, see alignment E=5.1e-23

Best Hits

Swiss-Prot: 49% identical to ZNTR_ECO57: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli O157:H7

KEGG orthology group: K13638, MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA (inferred from 100% identity to son:SO_0443)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJM0 at UniProt or InterPro

Protein Sequence (163 amino acids)

>SO0443 transcriptional regulator, MerR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MYRIGELADLCEVKADTLRFYEKHGLLAPSSRTDSGYRVYTDADAARLRFILRAKAVGFT
LSEISELLSIDLDKSNWACADVKGMVDLKLAQVQAKIAELLHFQTSLQSLSNACCGGPRS
AEHCSILEALESSTERVRFEHDHGPGSHSEHAHIAATADKSGD