Protein Info for SO0370 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 135 (27 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 11 to 158 (148 residues), 106.9 bits, see alignment E=5.6e-35

Best Hits

KEGG orthology group: K09936, hypothetical protein (inferred from 100% identity to son:SO_0370)

Predicted SEED Role

"FIG073159: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJT7 at UniProt or InterPro

Protein Sequence (163 amino acids)

>SO0370 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQVSNKLTLLMSFVALCSGVLLALMIKLNSQLAMYSSPLWASWMAHGIGAITVLLMLFLL
RKMLMGKEAKSALNADANLSRLPWWAYLGGVPGAATVVLAAVTVNSELALAGTLALMLVG
QLILSCIFDCCGYFGVVKRRIRFTEVIAMVMILLGAMLVIYSH