Protein Info for SO0346 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator. GntR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00392: GntR" amino acids 17 to 78 (62 residues), 55.7 bits, see alignment E=3.2e-19 PF07729: FCD" amino acids 88 to 211 (124 residues), 109.5 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0346)

Predicted SEED Role

"Propionate catabolism operon transcriptional regulator of GntR family [predicted]" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJW0 at UniProt or InterPro

Protein Sequence (238 amino acids)

>SO0346 transcriptional regulator. GntR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKVKSLASEKSSTTLADQILVQIQTSIIKGELPAGSKINEQALAEKYGISRGPTREALQ
TLERQRLVVRAPHVGARVAQLTVSELNDLYQLRSVLEGMACELAASRITPEQLAKLEDLL
AVQETALANGDTYFQEEGDVDFHYQIIQASGNKHLQETLIGGLYHLLRMYRYQCTNKNRP
VKAIAEHRRIVEAIAQRDGELASLLMRRHIEQGRKNTELRLIELQANAAAKETLANIS