Protein Info for SO0345 in Shewanella oneidensis MR-1

Name: prpB
Annotation: methylisocitrate lyase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR02317: methylisocitrate lyase" amino acids 6 to 289 (284 residues), 423.7 bits, see alignment E=1.6e-131 PF13714: PEP_mutase" amino acids 9 to 252 (244 residues), 158.2 bits, see alignment E=2.7e-50 PF00463: ICL" amino acids 80 to 191 (112 residues), 50 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 100% identical to PRPB_SHEON: 2-methylisocitrate lyase (prpB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 100% identity to son:SO_0345)

MetaCyc: 63% identical to 2-methylcitrate lyase (Cupriavidus necator)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJW1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SO0345 methylisocitrate lyase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQSAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGM
TSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQKR
CGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGA
DMIFAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFRA
ANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK