Protein Info for SO0296 in Shewanella oneidensis MR-1

Annotation: integral membrane domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details PF00892: EamA" amino acids 7 to 136 (130 residues), 63.5 bits, see alignment E=1.3e-21 amino acids 146 to 268 (123 residues), 36.8 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0296)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK10 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SO0296 integral membrane domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQRPVVIGLILLIVGNLFSAFYDVSIKWLPEDANAATFLLVRQITSVLMLTPIWLYSQRP
QTEHISVHLWRANIGSVGALFLIIGLMALPLATVSSLFYSAPLMIILMGYWFLKERITTG
QVICTLLGFVGILIILRPSEMNWFGLAVLFSAFTFAVNQLTLKKVPSTEHPVLTLMLYNL
LGIPATLVIAAFQGLEGLSWELLVVALLSNAFLLIYHWLCVLAYRRAQASDIAIAEYTGL
LFIVFLGWLLFDEWLDSLSWLGAALIVLPSLFLPWIGMWVAKSPKVMDNLQVKSLGIDAA
VESEPKP