Protein Info for SO0289 in Shewanella oneidensis MR-1

Name: dam
Annotation: DNA adenine methylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00571: DNA adenine methylase" amino acids 6 to 269 (264 residues), 314.4 bits, see alignment E=3.7e-98 PF02086: MethyltransfD12" amino acids 11 to 253 (243 residues), 244.6 bits, see alignment E=6.8e-77

Best Hits

Swiss-Prot: 63% identical to DMA_VIBCH: DNA adenine methylase (dam) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06223, DNA adenine methylase [EC: 2.1.1.72] (inferred from 100% identity to son:SO_0289)

MetaCyc: 61% identical to DNA adenine methyltransferase (Escherichia coli K-12 substr. MG1655)
Site-specific DNA-methyltransferase (adenine-specific). [EC: 2.1.1.72]

Predicted SEED Role

"Methyl-directed repair DNA adenine methylase (EC 2.1.1.72)" in subsystem DNA repair, bacterial (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK17 at UniProt or InterPro

Protein Sequence (279 amino acids)

>SO0289 DNA adenine methylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MIKKHRAFLKWAGGKFKLVDELANYLPTGERLVEPFVGAGSVFLNTDYPRYLLCDINQDL
INLYNIVKERPVEYIAAAKKLFVDEMNQKEAYYRVRTDFNKSNDPFLRSVYFLYLNRHGF
NGLCRYNRKGGFNVPFGSYKKPYFPEKEILAFSKKAQRAEFKCISYEKAFEQIRAGDVIY
CDPPYAPLSTTASFTTYVGAGFSLDDQALLARYSRHMALEQRIPVVISNHDIPLTRELYR
GAHLAKIQVQRNISQNGSGRNKVDELIALYDETYDPQDD