Protein Info for SO0279 in Shewanella oneidensis MR-1

Name: argH
Annotation: argininosuccinate lyase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 299 to 316 (18 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details TIGR00838: argininosuccinate lyase" amino acids 3 to 454 (452 residues), 616.6 bits, see alignment E=1.5e-189 PF00206: Lyase_1" amino acids 6 to 301 (296 residues), 289.3 bits, see alignment E=4.2e-90 PF14698: ASL_C2" amino acids 364 to 431 (68 residues), 86.4 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 100% identical to ARLY_SHEON: Argininosuccinate lyase (argH) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to son:SO_0279)

MetaCyc: 66% identical to argininosuccinate lyase (Escherichia coli K-12 substr. MG1655)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK27 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SO0279 argininosuccinate lyase (NCBI ptt file) (Shewanella oneidensis MR-1)
MALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSIAWADAIASVGIITATECSDLKK
ALNELLVEVKGDPAIILASGAEDIHSFVESALIAKVGDLGKKLHTGRSRNDQVATDLKLW
CQSEGAALVARLQTLRSELIALAEREFDAVMPGYTHLQRAQPVTFGHWCLAYVEMIERDF
SRLTDALKRANTCPLGSGALAGTAYQMDRHALALALNFASPTLNSLDSVSDRDHVVELCS
TASISMMHLSRMAEDLIFFNTGEAGFISLSDEVTSGSSLMPQKKNPDALELIRGKTGRVY
GSLVGILTTMKALPLAYNKDMQEDKEGLFDVVDSWAICLDMAALVLSGLVVNRPNALLAA
QQGYANATELADYLVSKGMPFREAHHVVGVAVVAAIAKKIPLEGFTLAEFKTFADIIEDD
VYPNLTIEACLAKRDVLGGTALTQVKQAIAAKKAG