Protein Info for SO0275 in Shewanella oneidensis MR-1

Name: argC
Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 3 to 325 (323 residues), 338.2 bits, E=3e-105
• PF01118: Semialdhyde_dh
  • amino acids 3 to 145 (143 residues), 83.8 bits, E=1.9e-27
• PF22698: Semialdhyde_dhC_1
  • amino acids 155 to 307 (153 residues), 151 bits, E=4.3e-48
• PF02774: Semialdhyde_dhC
  • amino acids 164 to 310 (147 residues), 56.3 bits, E=7.3e-19

Best Hits

Swiss-Prot: 100% identical to ARGC_SHEON: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to son:SO_0275)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

See P59309 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SO0275 N-acetyl-gamma-glutamyl-phosphate reductase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKNIAIIGASGYTGAQLTALVHAESELSIQGLYVSENSLDKGRALADLYPVYSHIELTLS
PLTEEAKANIVAEADAVVLATEHSVSLHLAAWFYSQGLAVFDLSGAYRFSDVAQYPKWYG
FEHEYPEVLAKAVYGLAEWNAKDVAATKMIAVPGCYPTASLTALKPLKNLLTSAYPVINA
VSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATQLGQEVIFTPHLGNFKRGILAT
ITVQLKPGTTTADVAAAYSVYDQAPLVTVKQNQFPKVDDVVLTPNCHLGWKFDESSGYLV
VASAIDNLMKGAASQALQCIKIHFNL