Protein Info for SO0263 in Shewanella oneidensis MR-1

Name: ccmA
Annotation: heme exporter protein CcmA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 11 to 209 (199 residues), 240.6 bits, see alignment E=5.7e-76 PF00005: ABC_tran" amino acids 27 to 165 (139 residues), 96 bits, see alignment E=3.1e-31

Best Hits

Swiss-Prot: 100% identical to CCMA_SHEON: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to son:SO_0263)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK40 at UniProt or InterPro

Protein Sequence (216 amino acids)

>SO0263 heme exporter protein CcmA (NCBI ptt file) (Shewanella oneidensis MR-1)
MTNIISVDTLLSASKLTCIREERILFDELSFEINAGDIVQIEGPNGAGKTSLLRILAGLS
RPYAGQTFYVNEDINRCRDEYNEDLLYLGHLAGVKSELTAEENLNFNLRISGYDDFDTSA
ILAKVNLSGFEEALAGHLSAGQHRRTALARLWHNDCKIWILDEPFTAIDKRGVEELEQLF
IKHADNGGCVILTTHQDMGIIKDDRLRKIRLDYRFV