Protein Info for SO0260 in Shewanella oneidensis MR-1

Name: ccmD
Annotation: heme exporter protein CcmD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03141: heme exporter protein CcmD
  • amino acids 10 to 55 (46 residues), 75.6 bits, E=1.2e-25
• PF04995: CcmD
  • amino acids 13 to 56 (44 residues), 68.9 bits, E=1.6e-23

Best Hits

Swiss-Prot: 44% identical to CCMD_HAEIN: Heme exporter protein D (ccmD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02196, heme exporter protein D (inferred from 94% identity to sbn:Sbal195_0228)

MetaCyc: 41% identical to cytochrome c maturation protein D (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (7/11 steps found)

Sequence Analysis Tools

See Q8EK43 at UniProt or InterPro

Protein Sequence (66 amino acids)

>SO0260 heme exporter protein CcmD (NCBI ptt file) (Shewanella oneidensis MR-1)
MQFDSISDFFNMGGYAFYVWLAYGVTFFCLSTLIITSARQKRKVLIEIAKKMNREERLKE
TRSNKS