Protein Info for SO0220 in Shewanella oneidensis MR-1

Name: rplK
Annotation: ribosomal protein L11 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01632: ribosomal protein uL11
  • amino acids 3 to 141 (139 residues), 214 bits, E=3.7e-68
• PF03946: Ribosomal_L11_N
  • amino acids 9 to 67 (59 residues), 104.8 bits, E=1.6e-34
• PF00298: Ribosomal_L11
  • amino acids 72 to 140 (69 residues), 88.4 bits, E=3.4e-29

Best Hits

Swiss-Prot: 100% identical to RL11_SHEON: 50S ribosomal protein L11 (rplK) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02867, large subunit ribosomal protein L11 (inferred from 99% identity to she:Shewmr4_0188)

MetaCyc: 79% identical to 50S ribosomal subunit protein L11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L11p (L12e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See Q8EK78 at UniProt or InterPro

Protein Sequence (142 amino acids)

>SO0220 ribosomal protein L11 (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKKIDAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNARTEKMEKGMPIPVVIT
VYSDRSFTFETKTPPASYLLKTAAGLKSGSPRPNTQKVGTIARAKIQEIAEMKAADMTGA
DVEAMTRSIEGTARSMGLVVEG