Protein Info for SO0213 in Shewanella oneidensis MR-1

Name: murB
Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 7 to 332 (326 residues), 282 bits, E=2.6e-88
• PF01565: FAD_binding_4
  • amino acids 22 to 151 (130 residues), 82.5 bits, E=2.4e-27
• PF02873: MurB_C
  • amino acids 208 to 330 (123 residues), 97.8 bits, E=3.5e-32

Best Hits

Swiss-Prot: 100% identical to MURB_SHEON: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to son:SO_0213)

MetaCyc: 53% identical to UDP-N-acetylenolpyruvoylglucosamine reductase (Escherichia coli K-12 substr. MG1655)
UDPNACETYLMURAMATEDEHYDROG-RXN [EC: 1.3.1.98]

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan recycling I (9/14 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158 or 1.3.1.98

Sequence Analysis Tools

See Q8EK85 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SO0213 UDP-N-acetylenolpyruvoylglucosamine reductase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSFPYSLKSFNTFGVTQSCLSLIEVRSKAELQAICLPLYQSKQPMLVLGGGSNIVFTDDF
NGTVVRVLSKGISVTEDVSYFYLEIEAGENWHELVEFTLNNHMAGLENLALIPGTVGAAP
IQNIGAYGVELCDICHWVEYLDLDSGLLLRLSVDECEFSYRESIFKGRLRDKAVITAVGL
RLPKTWQPRLAYGPLQSFAADTVTPRDIFERVCEVRSEKLPDPHILGNAGSFFKNPIISA
AAYVELAQRFPNIVGYAQANGDVKLAAGWLIEHAGLKGFVLGNAGVHAKQALVLVNLGNA
TGQDICRLALHVIARVHDVFGVMLEAEPRIMGLNGETSLHV