Protein Info for SO0197 in Shewanella oneidensis MR-1

Annotation: fatty acid desaturase, family 1 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details PF00487: FA_desaturase" amino acids 39 to 260 (222 residues), 81.4 bits, see alignment E=4.8e-27

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 100% identity to son:SO_0197)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK98 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SO0197 fatty acid desaturase, family 1 (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKPPIIWLNVILFSLTFLSAVILVPWYGIVYGYGASEWIAFVVLAFASGLSITAGYHRL
WSHKAYKTHPAIRFLYALGGALALQNSALHWASDHRVHHKHVDDNDKDPYSAKMGFWYSH
IGWMLREYQAQRYHDYQNVRDLQNDRIVMWQHKHYLTLVLLMNIGLPALLGWFTGNIAGM
LLMAGLLRLVVVHHCTFFINSLAHVWGCQPYTDKNTARDNGFLAVLTYGEGYHNFHHIFE
NDYRNGIKWWHYDPTKWLIKSLSWVGLAKDLRTSPQERIESARLQMQLLHAKNKVLNLPN
ADEIIEKIQQEYELMKQHLLEYYQAQKTLLEAKRKQLVDQQLLQQVEELKTRFLNQQKSW
KSLTATYS