Protein Info for SO0191 in Shewanella oneidensis MR-1

Name: cysQ-1
Annotation: cysQ protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00459: Inositol_P" amino acids 4 to 250 (247 residues), 178.9 bits, see alignment E=7.5e-57 TIGR01331: 3'(2'),5'-bisphosphate nucleotidase" amino acids 7 to 256 (250 residues), 312.3 bits, see alignment E=1.4e-97

Best Hits

Swiss-Prot: 48% identical to CYSQ_AGGAC: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K03677, CysQ protein (inferred from 100% identity to son:SO_0191)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.7

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKA4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SO0191 cysQ protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKPEELIDEVIAIATDAGRTIRDIYLKGNFERETKSDNTPVTSADLAANKLICERLAALT
PDIPILSEEAADIPLSVREVWKCYWLVDPLDGTGEFIAGSGDFSVIVALVEHNRPVMGVV
YVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIQHREQVSLRLAVSRRQDPQSVLTLFNQ
PKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIIEEAGGQMMDTELQPL
TYNERETLENPNFIVVGAPNLAWDKILIGE