Protein Info for SO0177 in Shewanella oneidensis MR-1

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3 protein family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00702: Hydrolase" amino acids 7 to 183 (177 residues), 66.4 bits, see alignment E=4.7e-22 PF13419: HAD_2" amino acids 10 to 184 (175 residues), 40.7 bits, see alignment E=2.9e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 68 to 184 (117 residues), 42.4 bits, see alignment E=4.1e-15

Best Hits

Swiss-Prot: 49% identical to YRFG_SHIFL: GMP/IMP nucleotidase YrfG (yrfG) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to son:SO_0177)

MetaCyc: 49% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKB8 at UniProt or InterPro

Protein Sequence (220 amino acids)

>SO0177 HAD-superfamily hydrolase, subfamily IA, variant 3 protein family (NCBI ptt file) (Shewanella oneidensis MR-1)
MFDWKTIDTVLLDMDGTLLDLHFDNHFWLSLVPQELSRQRGLSQDQAHKLVVESYSKVAG
TLNWYCIDYWQTELQLDIMGLHRTLVDRIQLRQDSMPFLDALKAAGKKRILVTNAHPKSL
ALKLEHTELGSGLDAMISSHETGYPKEHPQFWQTLFKQFALVPEHCLFIDDSEPILNAAR
LAGVGHQLGISNPDSQKPAKTFNDFPAISDYRVLLNDLTS