Protein Info for SO0170 in Shewanella oneidensis MR-1

Name: gspH
Annotation: general secretion pathway protein H (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01708: type II secretion system protein H" amino acids 5 to 182 (178 residues), 70.1 bits, see alignment E=1.9e-23 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 7 to 28 (22 residues), 20.3 bits, see alignment (E = 3.7e-08) PF12019: GspH" amino acids 44 to 170 (127 residues), 28.3 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 100% identity to son:SO_0170)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKC5 at UniProt or InterPro

Protein Sequence (190 amino acids)

>SO0170 general secretion pathway protein H (NCBI ptt file) (Shewanella oneidensis MR-1)
MLMLRHAGFTLMEVMLVILLMGLTAAGVTMSIGNSGPQQALEKTAQQFIAATELVLDETV
LSGQFIGIVVEKTSYQFVFYKDGKWNPLEKDRILSEKQMEPGVVINLVLDGLPLVQEDEQ
DESWFEEPLIEPSSEDKKKHPEPQILLFPSGEMSAFELSFITKTDKGPLDVLVVGDALGR
LTLGRPDEIR