Protein Info for SO0169 in Shewanella oneidensis MR-1

Name: gspG
Annotation: general secretion pathway protein G (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF07963: N_methyl" amino acids 5 to 29 (25 residues), 40.7 bits, see alignment 1.2e-14 TIGR01710: type II secretion system protein G" amino acids 8 to 139 (132 residues), 190.7 bits, see alignment E=1e-60 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 8 to 29 (22 residues), 35.6 bits, see alignment 5.2e-13 PF08334: T2SSG" amino acids 32 to 138 (107 residues), 130.3 bits, see alignment E=3.1e-42

Best Hits

Swiss-Prot: 77% identical to GSPG_AERHY: Type II secretion system protein G (exeG) from Aeromonas hydrophila

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 98% identity to shm:Shewmr7_0154)

MetaCyc: 69% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKC6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>SO0169 general secretion pathway protein G (NCBI ptt file) (Shewanella oneidensis MR-1)
MQMNKKHKGFTLLEVMVVIVILGILASMVVPNLMGNKDKADQQKAVSDIVALENALDMYK
LDNGVYPTTEQGLEALVQKPTISPEPRNYREEGYVKRLPQDPWRNNYLLLSPGENSKLDI
FSAGPDSQPGTEDDIGNWNLQNFQ