Protein Info for SO0141 in Shewanella oneidensis MR-1

Annotation: sensory box protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1077 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details PF08376: NIT" amino acids 62 to 263 (202 residues), 41.4 bits, see alignment E=1.1e-13 PF05227: CHASE3" amino acids 291 to 374 (84 residues), 30.1 bits, see alignment 2.2e-10 PF00672: HAMP" amino acids 458 to 497 (40 residues), 23 bits, see alignment (E = 4.2e-08) PF13188: PAS_8" amino acids 510 to 548 (39 residues), 28.7 bits, see alignment (E = 4.5e-10) TIGR00229: PAS domain S-box protein" amino acids 511 to 629 (119 residues), 72.1 bits, see alignment E=4.6e-24 PF00989: PAS" amino acids 512 to 619 (108 residues), 50 bits, see alignment E=1.4e-16 PF08448: PAS_4" amino acids 517 to 623 (107 residues), 33.9 bits, see alignment E=1.7e-11 PF13426: PAS_9" amino acids 519 to 620 (102 residues), 62.5 bits, see alignment E=2e-20 PF08447: PAS_3" amino acids 533 to 614 (82 residues), 37.6 bits, see alignment 1.1e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 632 to 793 (162 residues), 142.1 bits, see alignment E=1.3e-45 PF00990: GGDEF" amino acids 633 to 790 (158 residues), 169.2 bits, see alignment E=3.1e-53 PF00563: EAL" amino acids 810 to 1047 (238 residues), 259.3 bits, see alignment E=1.6e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0141)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKF3 at UniProt or InterPro

Protein Sequence (1077 amino acids)

>SO0141 sensory box protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPSTLQHLSLKQKLILFSLLPLLMMSIFVLSRMYMLVKEYRFANQNHLAIRATVQTTDFL
FQLHNEYGLSTQLLPATTPQDETRLLQQQQITSAALEALLKSPALIELNATLSDQQASTQ
LQEKLTNLTLLSHKLASSRQEALDQHPSSFIVLYQQFNSSLLQLVQQLQLLTNDITQSRA
YADLLNLLMVQELAVKERSAINRMLLSDSLSINDYKAINTIMYEYGQAISHASNASISDR
HSLIRQIQASPESLRILKISQQIEQQIHISTLVQSINAHLGYEGLIDSFQDYLLTGSPAS
LAKFTKALTTIQQKLDELNRETVNLPSLAPAVQSIEESINQYQFCMSKIVQLKDQKLSLA
EITALAHINNSELSAAIDKLLMPPHPVSSKHWWTLTTDRINKLNALSNEITLSMARQSDI
QQHHALMLLGIYLLSALFTATITLWLGRKIIRSFMFKITQIANDMQQMAADPQLNIHIDV
SGSDELARMSRAMNRMLSERQKANQALSRAAAVFNYSAEGIMVTDADNHIELVNPAFSQI
TGYSLEDVKGRSPSMLSSKRHPSHFYTAMWEALQKDSKWEGEIWNKRKDGQVYPEYLAIT
VVRNERGEIIQHIGLFMDISKRKQYEQDLWYQAHFDTLTGLPNRKLFNERLQHEIQLAQH
DSRKLAILLIDLDQFKYINDVQGHATGDLLLQDVAKRLENIAGKNDLIARIGGDEFVLIL
PRVTNEFAIEHMASRIIETLSTPFNLNEREIQISASFGIGVYPEDGLDVSSLTRNTEMAM
YQAKDAGRNNFKYFTSGMNQAMFARMELEQRLRRAVAQDEFTLHYQPIVEMKTGKVCSVE
ALIRWQDPDLGLIPPDQFIGIAEETGLIEPMGEWVLNQAMHDLRQWQQLGLQLNVAINVS
SRQCVNARGMGFDQVLQECFNRHHINPRNVHIEITESMLMGDASHCLSTLEAIRRLGSQI
YIDDFGTGYSSLSYLKKFPISVIKIDRSFVENALSNNSNTNLVKAIVMMGQSLEMELVAE
GIETEAQWNLLRDLGCHYAQGYLISKPLPFAAITPLLSQTLPRLLQPQAPREKCVNA