Protein Info for SO0137 in Shewanella oneidensis MR-1

Name: moeB
Annotation: molybdopterin biosynthesis MoeB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR02355: molybdopterin synthase sulfurylase MoeB" amino acids 12 to 251 (240 residues), 452.4 bits, see alignment E=1.6e-140 PF00899: ThiF" amino acids 16 to 249 (234 residues), 261.4 bits, see alignment E=3e-82

Best Hits

Swiss-Prot: 61% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 100% identity to son:SO_0137)

MetaCyc: 61% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKF6 at UniProt or InterPro

Protein Sequence (253 amino acids)

>SO0137 molybdopterin biosynthesis MoeB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNEQVDILSDSELTRYSRQISIKAMDIDGQERLKLAKVLMIGAGGLGCAAGQYLTVAGIG
ELTLVDFDTVELSNLQRQVLHQDANIGQPKVESAKQSLNQLNPHVKINPINAVLDDHEID
ALVASHSIVVDCTDNVSVREQLNQSCFKHKVPLVSAAAIRMEGMVTVFDYQAQTPCYHCF
SSLFGEQQLSCVESGILAPVVGMVGCLQAVEAIKVITGIGKTLAGRILMIDAMTMEFREM
KLPKQAHCKICSQ