Protein Info for SO0096 in Shewanella oneidensis MR-1

Name: hutC
Annotation: histidine utilization repressor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR02018: histidine utilization repressor" amino acids 4 to 232 (229 residues), 329.3 bits, see alignment E=5.3e-103 PF00392: GntR" amino acids 8 to 68 (61 residues), 55.1 bits, see alignment E=7.1e-19 PF08220: HTH_DeoR" amino acids 32 to 63 (32 residues), 22.3 bits, see alignment 1.4e-08 PF07702: UTRA" amino acids 90 to 226 (137 residues), 123.5 bits, see alignment E=9.1e-40

Best Hits

Swiss-Prot: 52% identical to HUTC_PSEPU: Histidine utilization repressor (hutC) from Pseudomonas putida

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 100% identity to son:SO_0096)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKJ6 at UniProt or InterPro

Protein Sequence (235 amino acids)

>SO0096 histidine utilization repressor (NCBI ptt file) (Shewanella oneidensis MR-1)
MATPKFAEIKQYITGCIESGEWEENARVPSENQLAELFVCSRMTARRALTELTDNGVLER
SQGLGTFVAGRKSQSSMLAIRNIADEIKDRGHGYSVQQLALEQVNATAPIAIALALDVGS
PVFHSILVHCEQGVPLQVEERYVNPAFAPDYLVQDFSEQTPHEYLSQVAPLTEAHHTIEA
IIASSELQQRLAIPATEPCLQISRRTWSRQGVVSFAKLVHPGSRFKLGGHLTFNK