Protein Info for SO0074 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 30 to 55 (26 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 146 (17 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0074)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKL8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>SO0074 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTVKSLVQPTDKPATTHSINPFNGMLRLWLFDVGSVSFLGTGLLGVVLSVFAGWAGQKD
SFDIFVGMGIVSTSAAVAWQLIRLMANECSILIPRYRQNIFIQCEVMLIGVFSLAVLLCV
LFGFSASLSLLVFAQGISLGFILLCLRQTQWFYSSFLLFILVPFSSALAEQVPLWLSLAL
LFVFAALIWRRCLVLPWRVEARSVYLNGLEMGWFWLPNLQSMRFLSRFERYLHPVNFFIG
PMLTVLLLLLPVLALVLGVLFQLMHWDFPVLLLLAQFCVISCALVHWSRVQRARATALLL
LMPGFDGRTGLINAFARGQQRLLYLISVGVLLCSLFITWLNGEMSVPLLAHLVISTYWAC
ALVLGLGCLCRRVLQVSLTMLVVLAHSLWVSLSLAMQHDGHLYYWLLGDILLAVLGQVAL
FWGSKTLWRIDIDGL