Protein Info for SO0072 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator, GntR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF00392: GntR" amino acids 16 to 78 (63 residues), 62.1 bits, see alignment E=9.4e-21 PF13545: HTH_Crp_2" amino acids 37 to 72 (36 residues), 29.3 bits, see alignment E=2e-10 PF13730: HTH_36" amino acids 38 to 68 (31 residues), 25.5 bits, see alignment E=2.8e-09 PF12802: MarR_2" amino acids 39 to 74 (36 residues), 29.3 bits, see alignment E=2.3e-10 PF01047: MarR" amino acids 40 to 72 (33 residues), 29.5 bits, see alignment E=1.7e-10 PF08220: HTH_DeoR" amino acids 40 to 77 (38 residues), 21 bits, see alignment E=6.7e-08

Best Hits

KEGG orthology group: K07979, GntR family transcriptional regulator (inferred from 100% identity to son:SO_0072)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKM0 at UniProt or InterPro

Protein Sequence (123 amino acids)

>SO0072 transcriptional regulator, GntR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MLELLNVNPSSGEPIYKQLHEQIVRLIVGGQLQAEDVLPSVRQIAEYLAVNPMTVSRAIQ
QLVDQGWLERRRGQATRVAARTEAMESGVSLLEPQLDGLLAQAKQLGVSLPELLQLINER
WQA