Protein Info for SO0060 in Shewanella oneidensis MR-1

Annotation: sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details PF13493: DUF4118" amino acids 20 to 124 (105 residues), 65.1 bits, see alignment E=7.1e-22 PF00512: HisKA" amino acids 131 to 195 (65 residues), 49.6 bits, see alignment E=5.1e-17 PF02518: HATPase_c" amino acids 241 to 344 (104 residues), 70.8 bits, see alignment E=1.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0060)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKN2 at UniProt or InterPro

Protein Sequence (348 amino acids)

>SO0060 sensor histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTFANTASINHYWRTHPALFTAMLLVVVLITSYFIDVFSGSAIAVLLILQLAVVVVALQC
SANYAYFVAVFGAVSFNFLFTAPRYSLQMLNVEDIVNLTVFLLAALTSSKLAKHYRRQQD
ALEQAQLRNSILLSVSHDLRTPLATIIGTLTTLKEYQPKLSPAQTEELIDSAAAESHRLH
QYIENLLQANKLQHGALKFSLDEANIREVLQRTIARFQTEQPRIQIQSEPELPSLMICSS
LIEQAIFNVLDNALHYSPATQPVTVSLYRHQHMLRIDIQDQGKGIAPSQTGAIFELFYRQ
HPTTDGGAGLGLPVAKGIITAHNGTISAEKVAHGSLIRIALPITKESA