Protein Info for SO0058 in Shewanella oneidensis MR-1

Annotation: potassium uptake protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF02254: TrkA_N" amino acids 4 to 119 (116 residues), 85.2 bits, see alignment E=4.4e-28 PF03446: NAD_binding_2" amino acids 4 to 103 (100 residues), 23 bits, see alignment E=7.5e-09

Best Hits

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to son:SO_0058)

Predicted SEED Role

"K(+)-uptake protein KtrA, peripherally bound subunit; Trk system potassium uptake protein TrkA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKN4 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SO0058 potassium uptake protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MAHFTVIGLGRFGVAVSLELIHLGHTVTGVDSDHKAVEKYVEVLTEAVICDCADEAALRE
LDLASSEVVIVAIGLDMQSSLLCTLALKNLDVQTIWVKASNKAHHTILSKLGVARIIHPE
EDMGIRVAQSLNYPMVNNFLAIGNGLYIVEIHIKAHLNQTTVGLLLGSLHDNASNEQTNV
VRNPKGKVAPLMVKRELTVFSKIDSEFILYTEDALFLCGSRAELKLLAPRLV