Protein Info for SO0034 in Shewanella oneidensis MR-1

Annotation: DNA processing protein DprA, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00732: DNA protecting protein DprA" amino acids 43 to 257 (215 residues), 254.9 bits, see alignment E=2.4e-80 PF02481: DNA_processg_A" amino acids 49 to 257 (209 residues), 260.6 bits, see alignment E=8.3e-82 PF17782: WHD_DprA" amino acids 286 to 331 (46 residues), 38.2 bits, see alignment 1.2e-13

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to son:SO_0034)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKQ6 at UniProt or InterPro

Protein Sequence (338 amino acids)

>SO0034 DNA processing protein DprA, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MDVDDLRQRLEHEKHSLPLSDNLLHSLVIDYQKVDAALEWQQQAAHHHLVCFSDPLYPPL
LKQLTDPPCVLFVKGCVEALAIPSLAIVGSRNASPGGLQVAYQLAREMTALGFSICSGMA
MGIDGAAHKACVDHAGRTLAVLGTGIDIIYPRRHKQLYEDIQRQGCIISEFWPDVGPFAG
NFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMELGREVFAVPGSILGGFHQGCHDLL
RDGAKLVESAADIVEELASLTAFHLEEVNSCHHIQQGEICDLPFSSLLASVGYETTAIDA
VVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRVKRS