Protein Info for SO0023 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein TIGR00257 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00257: uncharacterized protein, YigZ family" amino acids 1 to 198 (198 residues), 205.6 bits, see alignment E=2.9e-65 PF01205: UPF0029" amino acids 19 to 124 (106 residues), 108.7 bits, see alignment E=1.6e-35 PF09186: DUF1949" amino acids 142 to 196 (55 residues), 41.2 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 49% identical to YIGZ_ECOLI: IMPACT family member YigZ (yigZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_0023)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKR7 at UniProt or InterPro

Protein Sequence (204 amino acids)

>SO0023 conserved hypothetical protein TIGR00257 (NCBI ptt file) (Shewanella oneidensis MR-1)
MLESYLIPSEDLQIEEEIKYSRFISFLFHCNSLEQLKLVLTDIKRDYPGASHYCYAFIAG
APNDSMLIGSSDDGEPAGSAGRPMLAVLQGASIGEIGAVVVRYYGGTKLGVGGLVRAYTS
GLRQGLAQLPTQLKQLRYPATLRCDYTQLRNVEHLLQQLDAVITDKQFAEAVDIHFAIGK
QQQRLLTESLATLSQGSLRADFKL