Protein Info for SO0009 in Shewanella oneidensis MR-1

Name: dnaN
Annotation: DNA polymerase III, beta subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 366 (366 residues), 360.3 bits, see alignment E=5.4e-112 PF00712: DNA_pol3_beta" amino acids 1 to 119 (119 residues), 122.7 bits, see alignment E=1.4e-39 PF02767: DNA_pol3_beta_2" amino acids 129 to 243 (115 residues), 120.1 bits, see alignment E=9.2e-39 PF02768: DNA_pol3_beta_3" amino acids 245 to 365 (121 residues), 135.2 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 57% identical to DPO3B_PSEAE: Beta sliding clamp (dnaN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 100% identity to son:SO_0009)

MetaCyc: 58% identical to beta sliding clamp (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKT1 at UniProt or InterPro

Protein Sequence (366 amino acids)

>SO0009 DNA polymerase III, beta subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKLTGTDLEVELVGQAVIH
GDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRFSLATLPAEEYPNVE
AFQAEIEFTLKQGVLKSLIDATQFSMANQDVRYYLNGLLIETEGNMLRAIATDGHRLALS
HRVIEAQLPEKQVIVPRKGVMEMARLLETDDLDIAISIGDNAIRATTSTTVFTSKLVDGR
FPDYRRVLPKGGDKIVIASRNHFKQALTRASILSNEKFRGVRIQLEAGLLKITANNPEQE
EAEEIIDVDYNNLPLEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALLENHLEEDSMYV
VMPMRL