Protein Info for SO0006 in Shewanella oneidensis MR-1

Name: rnpA
Annotation: ribonuclease P protein component (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00825: Ribonuclease_P
  • amino acids 6 to 112 (107 residues), 110.3 bits, E=2.6e-36
• TIGR00188: ribonuclease P protein component
  • amino acids 6 to 114 (109 residues), 101.3 bits, E=1.8e-33

Best Hits

Swiss-Prot: 100% identical to RNPA_SHEON: Ribonuclease P protein component (rnpA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 98% identity to shw:Sputw3181_4094)

MetaCyc: 52% identical to RNase P protein component (Escherichia coli K-12 substr. MG1655)
Ribonuclease P. [EC: 3.1.26.5]; 3.1.26.5 [EC: 3.1.26.5]

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

• tRNA processing (10/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

See Q8EKT4 at UniProt or InterPro

Protein Sequence (118 amino acids)

>SO0006 ribonuclease P protein component (NCBI ptt file) (Shewanella oneidensis MR-1)
MTSYTFTRELRLLTPAQFKSVFSNPIKASSAEITLLAIPNSEQHPRLGLTVAKRYVKRAN
QRNRIKRVIRDSFRLNQHNIPHLDIVVLVRNGVMEMENAELNKLIEKLWRKLSRRYNG