Protein Info for Rru_A3778 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF150 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF02576: RimP_N" amino acids 45 to 118 (74 residues), 70.9 bits, see alignment E=9.7e-24 PF17384: DUF150_C" amino acids 121 to 195 (75 residues), 41.1 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 100% identical to RIMP_RHORT: Ribosome maturation factor RimP (rimP) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 100% identity to rru:Rru_A3778)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMS3 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Rru_A3778 Protein of unknown function DUF150 (NCBI) (Rhodospirillum rubrum S1H)
MALWGWRGVGRRPTFFVFASLAPIGRDFLRRNGDDARMMGHLEKLLAPTLDAMGYEVVRV
TLLGSQNPTLQVMAERLDGVAMTVSDCETISRALGALLDVEDPIAGRYSLEISSPGIDRP
LTRPKDYARFAGHEARIETDRLIEGHRRMKGLLLGIDEDRTVRLRLIEGKAAEDGTLPEV
EIPFGAIVKAKLLLTDALIAKALKDAEALADEGEAAGGAVEGGVA