Protein Info for Rru_A3776 in Rhodospirillum rubrum S1H

Annotation: Methionine adenosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF00438: S-AdoMet_synt_N" amino acids 6 to 104 (99 residues), 125.9 bits, see alignment E=1.2e-40 TIGR01034: methionine adenosyltransferase" amino acids 7 to 386 (380 residues), 496.5 bits, see alignment E=2.3e-153 PF02772: S-AdoMet_synt_M" amino acids 118 to 232 (115 residues), 127.8 bits, see alignment E=3.8e-41 PF02773: S-AdoMet_synt_C" amino acids 234 to 376 (143 residues), 216 bits, see alignment E=2.5e-68

Best Hits

Swiss-Prot: 100% identical to METK2_RHORT: S-adenosylmethionine synthase 2 (metK2) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to rru:Rru_A3776)

MetaCyc: 54% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.6

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMS5 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Rru_A3776 Methionine adenosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MAQSEYLFTSESVSEGHPDKVCDRISDAIVDAFLAEDPHSRVALETMATTNFVVLAGEVR
GPDSLTHDRLKEIAREAIKDIGYEQRGFHWKDAEIVSHVHSQSADIAVGVDAAGNKDEGA
GDQGIMFGYACTETEELMPAPIALSHAILKSLAEFRHGGDTSFGPDSKSQVTLRYVDGKP
VGAASVVVSTQHAGNLSQDEVRELVRPHVLKVLPEGWMCPEEEFYVNPTGRFVIGGPDGD
CGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNVVAAGLAEKCVIQV
SYAIGVSKPLSVYVNTQGTGQVDEQRLAVVLQQLMDLSPRGIRQHLQLSRPIYARTAAYG
HFGRKPEKDGGFSWERTDLVAGLKTAFGA