Protein Info for Rru_A3764 in Rhodospirillum rubrum S1H

Annotation: GCN5-related N-acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 51 to 65 (15 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 42 to 140 (99 residues), 58.6 bits, see alignment E=1.5e-19 PF13673: Acetyltransf_10" amino acids 62 to 146 (85 residues), 31.2 bits, see alignment E=4e-11 PF13508: Acetyltransf_7" amino acids 63 to 141 (79 residues), 42.6 bits, see alignment E=1.3e-14 PF08445: FR47" amino acids 84 to 141 (58 residues), 22.8 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to rru:Rru_A3764)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMT7 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Rru_A3764 GCN5-related N-acetyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSADRPPPGVIARATPPAMIALAPVHGGVLATLHAAAFTPRDERPWTAEEFVALLGLPGV
FGFLAVDHDAPQGFVILRAVADEAEVLTLAVPPPHAGCGVGRRLMGAALAVVEARGGIRV
HLEVAEDNPSARALYARLGFTPKGRRRGYYRRGGRLVDAIVLGLEVQGA