Protein Info for Rru_A3759 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 66 (25 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 130 to 142 (13 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 165 (152 residues), 58.8 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3759)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMU2 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Rru_A3759 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSESLLPLVLFAVTMFFTPGPNNVMLTTSGAAFGFRRTFPHLLGVALGFPLMFVAVGLGL
GAAFTAIPGLQRLIALIGGCYLLYLAWRIATLPTTAPATDAAGEGKKAKARARPLGFLQA
AAFQWANPKGWVIVISALATFTSPSSLDAGDQRLAQILVIVVVFIAVGLASSAA