Protein Info for Rru_A3756 in Rhodospirillum rubrum S1H

Annotation: PAS/PAC Sensor Hybrid Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 PF08448: PAS_4" amino acids 18 to 102 (85 residues), 24.3 bits, see alignment E=7.5e-09 TIGR00229: PAS domain S-box protein" amino acids 142 to 265 (124 residues), 44.8 bits, see alignment E=6.3e-16 PF13188: PAS_8" amino acids 145 to 192 (48 residues), 22.7 bits, see alignment 1.7e-08 PF00512: HisKA" amino acids 278 to 343 (66 residues), 44.6 bits, see alignment E=3e-15 PF02518: HATPase_c" amino acids 388 to 496 (109 residues), 87 bits, see alignment E=3.1e-28 PF00072: Response_reg" amino acids 522 to 636 (115 residues), 40.7 bits, see alignment E=6.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3756)

Predicted SEED Role

"probable two-component sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMU5 at UniProt or InterPro

Protein Sequence (672 amino acids)

>Rru_A3756 PAS/PAC Sensor Hybrid Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MLPDSPQPDPPLTVQDLLDSLDDDLMVVDGAGRVISTGRRGAARLGLTDKAQALGCDPFA
LLPPDVATGRRSALARVVACCVAETLEDRHDGHWWSVRMIPLIERAAAGRPESRAEDRLA
RAVILRIRDVTGTRALALALGDSEERFRGTFDAAGHGMALIDTEGHFRMVNPMLRALLGI
DAAHPGDLAAVVFPGDIKIAIDMIRRLAAEIEPSLTVRLRFVGADGATVWGLVSATLQRP
RVGERAYVVMHLRDITQEQLAEGRLRAAKEEADRASRAKTRFLAAASHDLRQPLQALNMF
ISVLAGRENDPWRAAIIGKIEKTADALTALLDTLLDISKLDAGLMRCEPRDVMIGGLLAR
LSEEFQPLAVSRGLALRAVASSAAVHADPALVEIVLRNFLGNALRYTPSGRVLVGARRRG
DGVEIQVLDTGPGIAPEQHGLIFEDFHQVENPAREKGEGLGLGLAIVKRVALLLGARVGV
RSLPGRGSCFTIRLPGPQGRAIERPEDGLLGVSAQAARGLTVLLIDDDPAVLDGLTLVLE
AWDCEVLAFADLDGLREGLGSGGFLAAPDVILSDFRLGKGENGVEAVRLVRDHFAQAVPA
LLLTGDTAPQRLREADASGLPLLHKPVKPEVLRGALADVIAGGLTLDDGLPGGEGADPRA
VGPPGGGAGGGP